PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G085800.1
Common NamePHAVU_008G085800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 175aa    MW: 19465.9 Da    PI: 9.1725
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G085800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.7e-1096141348
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rWT+ E+ l++ + ++  +g+Wk I+++    +t  q+ s+ qky+
  Phvul.008G085800.1  96 RWTENEHRLFLIGLQKCSPGDWKNISKCYIPSKTSTQIASHAQKYM 141
                         9**************************9988*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.20489145IPR017930Myb domain
SuperFamilySSF466892.18E-1491145IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-1392144IPR006447Myb domain, plants
CDDcd001673.31E-796141No hitNo description
Gene3DG3DSA:1.10.10.605.7E-896140IPR009057Homeodomain-like
PfamPF002493.5E-796140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
VCVGASTVSI SNVSPHEYTS FKDNGESAYE FSTLTTQPIS PNVFCYNHAP TPSMVHAISP  60
NPIISEHVPS GWVQIPNDSN HSTPPVSKSH HKRYERWTEN EHRLFLIGLQ KCSPGDWKNI  120
SKCYIPSKTS TQIASHAQKY MLHQNGLKKN KKRKSIHDVT LDNINTGVVP SFIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140122.11e-127hypothetical protein PHAVU_008G085800g, partial
TrEMBLV7B6L31e-127V7B6L3_PHAVU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1852625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-26MYB family protein